IGF-1 LR3

$89.00

What Is IGF-1 LR3?

IGF-1 LR3 (Insulin-like Growth Factor 1 Long Arg3) is a synthetic analogue of IGF-1, modified with an arginine substitution at position 3 and a 13-amino-acid N-terminal extension to significantly reduce IGF-binding protein affinity. In research settings, IGF-1 LR3 is studied for its prolonged IGF-1 receptor engagement and downstream anabolic signaling pathway activation.

BioRhex supplies IGF-1 LR3 as a research compound manufactured in a GMP-compliant US facility, tested to ≥99% purity via HPLC and mass spectrometry, and supplied strictly for controlled laboratory research — not for human or animal use.

Compound Overview

IGF-1 LR3 is a modified IGF-1 analogue studied for its enhanced receptor bioavailability and downstream signaling properties. In vitro and preclinical research models examine how IGF-1 LR3 may influence:

• IGF-1 receptor (IGF1R) binding affinity and activation dynamics
• PI3K/Akt/mTOR anabolic signaling cascade interactions
• Cellular proliferation and differentiation pathway signaling in experimental models
• Satellite cell biology and muscle fiber pathway research in preclinical systems
• Insulin receptor cross-reactivity and metabolic pathway interactions
All findings referenced are from controlled research environments and do not represent clinical outcomes or therapeutic claims.

History of IGF-1 LR3

IGF-1 LR3 was developed as a research tool to extend the effective activity window of IGF-1 in laboratory settings. Standard IGF-1 has a short receptor engagement duration due to high-affinity binding to IGF-binding proteins (IGFBPs). The LR3 modification — N-terminal extension with Arg3 substitution — substantially reduces IGFBP affinity, enabling prolonged IGF-1 receptor interaction in research models.

Its extended bioavailability profile made IGF-1 LR3 a practical tool for studying sustained IGF-1 receptor signaling in cell biology, anabolic pathway research, and growth factor pharmacology.
IGF-1 LR3 remains a widely referenced compound in anabolic signaling and cellular growth pathway research within laboratory environments.

Structure

Reserch-grade coenzyme compound visualization.

COMPOUND

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

TYPE

Long-acting IGF-1 analog

MOLECULAR FORMULA

C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉

MOLECULAR WEIGHT

9117.53 g/mol

PURITY

≥99%

ANALYSIS

HPLC Verified

STORAGE

Store at -20°C. Protect from light and moisture.

CLASSIFICATION

Reserch Use Only

Research Findings

Published and preclinical research on IGF-1 LR3 covers several areas of scientific investigation, including:

  • IGF-1 receptor pharmacology: Studies examine LR3’s binding affinity, receptor occupancy kinetics, and downstream phosphorylation signaling compared to native IGF-1.

  • mTOR pathway modeling: Research investigates Akt phosphorylation and mTOR complex activity in IGF-1 LR3-stimulated cellular models.

  • Cellular growth response research: Laboratory studies evaluate proliferative and anti-apoptotic signaling downstream of IGF1R activation.

  • Muscle biology research: Preclinical models examine IGF-1 LR3’s interactions with satellite cell and myoblast pathway signaling.

All findings referenced are from controlled, non-clinical research models and do not imply therapeutic or clinical application.

References

1. Tomas FM, Knowles SE, Owens PC, et al. (1992). Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats. Biochemical Journal, 282(1), 91–97. https://doi.org/10.1042/bj2820091

2. Tomas FM, Knowles SE, Owens PC, et al. (1993). Insulin-like growth factor-I and more potent variants restore growth of diabetic rats without inducing all characteristic insulin effects. Biochemical Journal, 291(3), 781–786. https://doi.org/10.1042/bj2910781

3. Tomas FM, Knowles SE, Chandler CS, et al. (1993). Anabolic effects of insulin-like growth factor-I (IGF-I) and an IGF-I variant in normal female rats. Journal of Endocrinology, 137(3), 413–421. https://doi.org/10.1677/joe.0.1370413

4. Puche JE, Castilla-Cázar I. (2012). Human conditions of insulin-like growth factor-I (IGF-I) deficiency. Journal of Translational Medicine, 10, 224. https://doi.org/10.1186/1479-5876-10-224

FAQ

What type of research is IGF-1 LR3 used for?

IGF-1 LR3 is used in laboratory research settings. All supplied compounds are intended strictly for in vitro and preclinical research purposes. Use is limited to controlled scientific environments.

All BioRhex compounds, including IGF-1 LR3, are manufactured in a GMP-compliant facility located in the United States.

Every batch of IGF-1 LR3 undergoes third-party HPLC purity testing, mass spectrometry identity verification, and sterility testing. A Certificate of Analysis is included with every order, documenting batch-specific purity data at a ≥99% threshold.

No. IGF-1 LR3 is not FDA-approved and is not intended for human or animal administration. It is supplied exclusively for laboratory research purposes.

Only qualified personnel in controlled laboratory settings following appropriate safety and handling protocols.

Research Use Only

All BioRhex compounds are supplied strictly for laboratory research purposes. Not for human or animal consumption, medical use, or therapeutic application. IGF-1 LR3 is not FDA-approved for any medical purpose. Nothing on this page should be interpreted as health guidance or applied outside controlled research settings.

RELATED PRODUCTS